Lineage for d1f7ob_ (1f7o B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.85: beta-clip [51268] (5 superfamilies) Superfamily b.85.4: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51283] (1 family) 
Family b.85.4.1: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51284] (1 protein) Protein Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) [51285] (3 species) 
Species Feline immunodeficiency virus [TaxId:11673] [51287] (8 PDB entries) 
Domain d1f7ob_: 1f7o B: [28358]
Details for d1f7ob_
PDB Entry: 1f7o (more details), 2.2 Å
PDB Description: crystal structures of feline immunodeficiency virus dutp pyrophosphatase and its nucleotide complexes in three crystal forms.
SCOP Domain Sequences for d1f7ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f7ob_ b.85.4.1 (B:) Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) {Feline immunodeficiency virus}
miiegdgildkrsedagydllaakeihllpgevkviptgvklmlpkgywgliigkssigs
kgldvlggvidegyrgeigviminvsrksitlmerqkiaqliilpckhevleqgkv
SCOP Domain Coordinates for d1f7ob_:
Click to download the PDB-style file with coordinates for d1f7ob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f7ob_:
- d1f7ob_ appears in SCOP 1.57
- d1f7ob_ appears in the current release, SCOPe 2.08
View in 3D
