Lineage for d1ggra_ (1ggr A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234880Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 234982Superfamily b.84.3: Duplicated hybrid motif [51261] (1 family) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 234983Family b.84.3.1: Glucose permease-like [51262] (2 proteins)
  6. 234990Protein Glucose-specific factor III (glsIII) [51266] (1 species)
    synonym: enzyme IIa-glc
  7. 234991Species Escherichia coli [TaxId:562] [51267] (9 PDB entries)
  8. 235001Domain d1ggra_: 1ggr A: [28279]
    Other proteins in same PDB: d1ggrb_
    complexed with po3

Details for d1ggra_

PDB Entry: 1ggr (more details)

PDB Description: complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d1ggra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggra_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk

SCOP Domain Coordinates for d1ggra_:

Click to download the PDB-style file with coordinates for d1ggra_.
(The format of our PDB-style files is described here.)

Timeline for d1ggra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ggrb_