SCOP 1.63: Domain d1ggra_: 1ggr A:

Lineage for d1ggra_ (1ggr A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.3: Duplicated hybrid motif [51261] (1 family)
   half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets

5. Family b.84.3.1: Glucose permease-like [51262] (2 proteins)

6. Protein Glucose-specific factor III (glsIII) [51266] (1 species)
   synonym: enzyme IIa-glc

7. Species Escherichia coli [TaxId:562] [51267] (9 PDB entries)

8. Domain d1ggra_: 1ggr A: [28279]
   Other proteins in same PDB: d1ggrb_
   complexed with po3

Details for d1ggra_

PDB Entry: 1ggr

PDB Description: complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

SCOP Domain Sequences for d1ggra_:

Sequence; same for both SEQRES and ATOM records:

>d1ggra_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk

Timeline for d1ggra_:

• d1ggra_ first appeared (with stable ids) in SCOP 1.55
  
• d1ggra_ appears in SCOP 1.61
  
• d1ggra_ appears in SCOP 1.65
  
• d1ggra_ appears in the current release, SCOPe 2.08