Lineage for d1ggra_ (1ggr A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) 
Superfamily b.84.3: Duplicated hybrid motif [51261] (1 family) 
Family b.84.3.1: Glucose permease-like [51262] (2 proteins) 
Protein Glucose-specific factor III (glsIII) [51266] (1 species) Species Escherichia coli [TaxId:562] [51267] (9 PDB entries) 
Domain d1ggra_: 1ggr A: [28279]
Other proteins in same PDB: d1ggrb_
Details for d1ggra_
PDB Entry: 1ggr (more details)
PDB Description: complex of enzyme iiaglc and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
SCOP Domain Sequences for d1ggra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggra_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk
SCOP Domain Coordinates for d1ggra_:
Click to download the PDB-style file with coordinates for d1ggra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ggra_:
- d1ggra_ appears in SCOP 1.57
- d1ggra_ appears in the current release, SCOPe 2.08
View in 3D
