Lineage for d5c05b1 (5c05 B:65-268)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722844Family a.102.4.0: automated matches [227201] (1 protein)
    not a true family
  6. 2722845Protein automated matches [226931] (12 species)
    not a true protein
  7. 2722901Species Thymus vulgaris [TaxId:49992] [280258] (1 PDB entry)
  8. 2722903Domain d5c05b1: 5c05 B:65-268 [280260]
    Other proteins in same PDB: d5c05a2, d5c05b2
    automated match to d2onha1
    complexed with edo

Details for d5c05b1

PDB Entry: 5c05 (more details), 1.65 Å

PDB Description: crystal structure of gamma-terpinene synthase from thymus vulgaris
PDB Compounds: (B:) Putative gamma-terpinene synthase

SCOPe Domain Sequences for d5c05b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c05b1 a.102.4.0 (B:65-268) automated matches {Thymus vulgaris [TaxId: 49992]}
vwnndfiqsfstdkykdekflkkkeeliaqvkvllntkmeavkqleliedlrnlgltyyf
edefkkiltsiynehkgfkneqvgdlyftslafrllrlhgfdvsedvfnffknedgsdfk
aslgentkdvlelyeasflirvgevtleqarvfstkilekkveegikdekllawiqhsla
lplhwriqrlearwfldaykarkd

SCOPe Domain Coordinates for d5c05b1:

Click to download the PDB-style file with coordinates for d5c05b1.
(The format of our PDB-style files is described here.)

Timeline for d5c05b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5c05b2