Lineage for d5c05b2 (5c05 B:269-596)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010904Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2010905Protein automated matches [196409] (36 species)
    not a true protein
  7. 2011036Species Thymus vulgaris [TaxId:49992] [280262] (1 PDB entry)
  8. 2011038Domain d5c05b2: 5c05 B:269-596 [280265]
    Other proteins in same PDB: d5c05a1, d5c05b1
    automated match to d2onha2
    complexed with edo

Details for d5c05b2

PDB Entry: 5c05 (more details), 1.65 Å

PDB Description: crystal structure of gamma-terpinene synthase from thymus vulgaris
PDB Compounds: (B:) Putative gamma-terpinene synthase

SCOPe Domain Sequences for d5c05b2:

Sequence, based on SEQRES records: (download)

>d5c05b2 a.128.1.0 (B:269-596) automated matches {Thymus vulgaris [TaxId: 49992]}
mnpiiyelgkidfhiiqetqlqevqevsqwwtntnlaeklpfvrdrivecyfwalglfep
heygyqrkmaaiiitfvtiiddvydvydtldelqlftdairkwdvesistlpyymqvcyl
avftyaselaydilkdqgfnsisylqrswlslvegffqeakwyyagytptlaeylenakv
sissptiisqvyftlpnstertvvenvfgyhnilylsgmilrladdlgttqfelkrgdvq
kaiqcymndnnateeegtehvkyllreawqemnsamadpdcplsedlvfaaanlgrtsqf
iyldgdghgvqhseihnqmgglifepyv

Sequence, based on observed residues (ATOM records): (download)

>d5c05b2 a.128.1.0 (B:269-596) automated matches {Thymus vulgaris [TaxId: 49992]}
mnpiiyelgkidfhiiqetqlqevqevsqwwtntnlaeklpfvrdrivecyfwalglfep
heygyqrkmaaiiitfvtiiddvydvydtldelqlftdairkwdvesistlpyymqvcyl
avftyaselaydilkdqgfnsisylqrswlslvegffqeakwyyagytptlaeylenakv
sissptiisqvyftlpnstertvvenvfgyhnilylsgmilrladdlgttqfelkrgdvq
kaiqcymndnnateeegtehvkyllreawqemnsamadpdcplsedlvfaaanlgrtsqf
iyldihnqmgglifepyv

SCOPe Domain Coordinates for d5c05b2:

Click to download the PDB-style file with coordinates for d5c05b2.
(The format of our PDB-style files is described here.)

Timeline for d5c05b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5c05b1