SCOPe 2.05: Domain d5c4oa_: 5c4o A:

Lineage for d5c4oa_ (5c4o A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (19 PDB entries)

8. Domain d5c4oa_: 5c4o A: [279885]
   automated match to d3l0ja_
   complexed with 4f1, gol, so4

Details for d5c4oa_

PDB Entry: 5c4o, 2.24 Å

PDB Description: identification of a novel allosteric binding site for rorgt inhibitors

PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5c4oa_:

Sequence; same for both SEQRES and ATOM records:

>d5c4oa_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
elafhhhlhkthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplykelf
s

Timeline for d5c4oa_:

• d5c4oa_ is new in SCOPe 2.05-stable
  
• d5c4oa_ appears in SCOPe 2.06
  
• d5c4oa_ appears in the current release, SCOPe 2.08