Lineage for d5c4oa_ (5c4o A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2730080Domain d5c4oa_: 5c4o A: [279885]
    automated match to d3l0ja_
    complexed with 4f1, gol, so4

Details for d5c4oa_

PDB Entry: 5c4o (more details), 2.24 Å

PDB Description: identification of a novel allosteric binding site for rorgt inhibitors
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5c4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c4oa_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
elafhhhlhkthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplykelf
s

SCOPe Domain Coordinates for d5c4oa_:

Click to download the PDB-style file with coordinates for d5c4oa_.
(The format of our PDB-style files is described here.)

Timeline for d5c4oa_: