Lineage for d5a4mt_ (5a4m T:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624800Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2624801Protein automated matches [191172] (11 species)
    not a true protein
  7. 2624817Species Escherichia coli [TaxId:1403831] [279531] (3 PDB entries)
  8. 2624823Domain d5a4mt_: 5a4m T: [279538]
    Other proteins in same PDB: d5a4ml_, d5a4mm_
    automated match to d3uqys_
    complexed with cl, f3s, mg, nfv, sf3, sf4

Details for d5a4mt_

PDB Entry: 5a4m (more details), 1.7 Å

PDB Description: mechanism of hydrogen activation by nife-hydrogenases
PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d5a4mt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4mt_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 1403831]}
pripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedii
tqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqaa
rpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfygq
rihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpiq
sghgclgcaengfwdrgsfysr

SCOPe Domain Coordinates for d5a4mt_:

Click to download the PDB-style file with coordinates for d5a4mt_.
(The format of our PDB-style files is described here.)

Timeline for d5a4mt_: