PDB entry 5a4m

View 5a4m on RCSB PDB site
Description: Mechanism of Hydrogen activation by NiFe-hydrogenases
Class: oxidoreductase
Keywords: oxidoreductase, hydrogen activation, nife hydrogenase, fes clusters, catalysis, transmembrane domain
Deposited on 2015-06-10, released 2015-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Hydrogenase-1 large chain
    Species: ESCHERICHIA COLI STR. K-12 SUBSTR. MC4100 [TaxId:1403831]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a4ml_
  • Chain 'M':
    Compound: Hydrogenase-1 large chain
    Species: ESCHERICHIA COLI STR. K-12 SUBSTR. MC4100 [TaxId:1403831]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a4mm_
  • Chain 'S':
    Compound: Hydrogenase-1 small chain
    Species: ESCHERICHIA COLI STR. K-12 SUBSTR. MC4100 [TaxId:1403831]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a4ms_
  • Chain 'T':
    Compound: Hydrogenase-1 small chain
    Species: ESCHERICHIA COLI STR. K-12 SUBSTR. MC4100 [TaxId:1403831]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5a4mt_
  • Heterogens: NFV, MG, SF4, F3S, SF3, CL, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5a4mL (L:)
    mstqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a4mL (L:)
    stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5a4mM (M:)
    mstqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a4mM (M:)
    stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5a4mS (S:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrgsfysrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a4mS (S:)
    kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
    itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
    arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
    qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
    qsghgclgcaengfwdrgsfysr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5a4mT (T:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrgsfysrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5a4mT (T:)
    pripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedii
    tqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqaa
    rpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfygq
    rihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpiq
    sghgclgcaengfwdrgsfysr