Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (11 species) not a true protein |
Species Escherichia coli [TaxId:1403831] [279531] (3 PDB entries) |
Domain d5a4mt_: 5a4m T: [279538] Other proteins in same PDB: d5a4ml_, d5a4mm_ automated match to d3uqys_ complexed with cl, f3s, mg, nfv, sf3, sf4 |
PDB Entry: 5a4m (more details), 1.7 Å
SCOPe Domain Sequences for d5a4mt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a4mt_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 1403831]} pripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedii tqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqaa rpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfygq rihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpiq sghgclgcaengfwdrgsfysr
Timeline for d5a4mt_: