Lineage for d1jda_1 (1jda 358-418)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 233630Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 233631Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 233632Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 233786Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51038] (1 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 233787Species Pseudomonas stutzeri [TaxId:316] [51039] (9 PDB entries)
  8. 233795Domain d1jda_1: 1jda 358-418 [27795]
    Other proteins in same PDB: d1jda_2
    complexed with ca; mutant

Details for d1jda_1

PDB Entry: 1jda (more details), 2.2 Å

PDB Description: maltotetraose-forming exo-amylase

SCOP Domain Sequences for d1jda_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jda_1 b.71.1.1 (358-418) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri}
radsaisfhsgysglvatvsgsqqtlvvalnsdlgnpgqvasgsfseavnasngqvrvwr
s

SCOP Domain Coordinates for d1jda_1:

Click to download the PDB-style file with coordinates for d1jda_1.
(The format of our PDB-style files is described here.)

Timeline for d1jda_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jda_2