SCOP 1.65: Domain d1jda_1: 1jda 358-418

Lineage for d1jda_1 (1jda 358-418)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51038] (1 species)
   single beta-sheet; probable result of a decay of the common-fold

7. Species Pseudomonas stutzeri [TaxId:316] [51039] (9 PDB entries)

8. Domain d1jda_1: 1jda 358-418 [27795]
   Other proteins in same PDB: d1jda_2
   complexed with ca; mutant

Details for d1jda_1

PDB Entry: 1jda, 2.2 Å

PDB Description: maltotetraose-forming exo-amylase

SCOP Domain Sequences for d1jda_1:

Sequence; same for both SEQRES and ATOM records:

>d1jda_1 b.71.1.1 (358-418) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri}
radsaisfhsgysglvatvsgsqqtlvvalnsdlgnpgqvasgsfseavnasngqvrvwr
s

Timeline for d1jda_1:

• d1jda_1 first appeared (with stable ids) in SCOP 1.55
  
• d1jda_1 appears in SCOP 1.63
  
• d1jda_1 appears in SCOP 1.67
  
• d1jda_1 appears in the current release, SCOPe 2.08, called d1jdaa1