Class b: All beta proteins [48724] (119 folds) |
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (2 PDB entries) |
Domain d1ciu_3: 1ciu 407-495 [27759] Other proteins in same PDB: d1ciu_1, d1ciu_2, d1ciu_4 complexed with ca |
PDB Entry: 1ciu (more details), 2.3 Å
SCOP Domain Sequences for d1ciu_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ciu_3 b.71.1.1 (407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1} gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng nsisvasdgsvtpftlsagevavwqyvss
Timeline for d1ciu_3: