Lineage for d1ciua3 (1ciu A:407-495)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810494Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2810558Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (4 PDB entries)
  8. 2810561Domain d1ciua3: 1ciu A:407-495 [27759]
    Other proteins in same PDB: d1ciua1, d1ciua2, d1ciua4
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1ciua3

PDB Entry: 1ciu (more details), 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1ciua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ciua3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng
nsisvasdgsvtpftlsagevavwqyvss

SCOPe Domain Coordinates for d1ciua3:

Click to download the PDB-style file with coordinates for d1ciua3.
(The format of our PDB-style files is described here.)

Timeline for d1ciua3: