Lineage for d8cgta3 (8cgt A:407-494)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (14 proteins) 
Protein Cyclodextrin glycosyltransferase [51018] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries) 
Domain d8cgta3: 8cgt A:407-494 [27738]
Other proteins in same PDB: d8cgta1, d8cgta2, d8cgta4
Details for d8cgta3
PDB Entry: 8cgt (more details), 2.4 Å
PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltohexaose
SCOP Domain Sequences for d8cgta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d8cgta3 b.71.1.1 (A:407-494) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqqrwinndvyvyerkfgksvavvavnrnlstsasitglstslptgsytdvlggvlng
nnitstngsinnftlaagatavwqytta
SCOP Domain Coordinates for d8cgta3:
Click to download the PDB-style file with coordinates for d8cgta3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d8cgta3:
- d8cgta3 first appeared (with stable ids) in SCOP 1.55
- d8cgta3 appears in SCOP 1.59
- d8cgta3 appears in SCOP 1.63
- d8cgta3 appears in the current release, SCOPe 2.08
View in 3D
