Lineage for d8cgta1 (8cgt A:495-579)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein Cyclodextrin glycosyltransferase, domain E [49215] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [49216] (29 PDB entries) 
Domain d8cgta1: 8cgt A:495-579 [21831]
Other proteins in same PDB: d8cgta2, d8cgta3, d8cgta4
Details for d8cgta1
PDB Entry: 8cgt (more details), 2.4 Å
PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltohexaose
SCOP Domain Sequences for d8cgta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8cgta1 b.1.1.5 (A:495-579) Cyclodextrin glycosyltransferase, domain E {Bacillus circulans, different strains}
ettptighvgpvmgkpgnvvtidgrgfgstkgtvyfgttavtgaaitswedtqikvtips
vaagnyavkvaasgvnsnaynnfti
SCOP Domain Coordinates for d8cgta1:
Click to download the PDB-style file with coordinates for d8cgta1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d8cgta1:
- d8cgta1 first appeared (with stable ids) in SCOP 1.55
- d8cgta1 appears in SCOP 1.59
- d8cgta1 appears in SCOP 1.63
- d8cgta1 appears in the current release, SCOPe 2.08
View in 3D
