Lineage for d8cgta2 (8cgt A:580-684)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162042Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 162043Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 162044Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 162054Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
  7. 162055Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries)
  8. 162066Domain d8cgta2: 8cgt A:580-684 [22500]
    Other proteins in same PDB: d8cgta1, d8cgta3, d8cgta4

Details for d8cgta2

PDB Entry: 8cgt (more details), 2.4 Å

PDB Description: structure of cyclodextrin glycosyltransferase complexed with a thio- maltohexaose

SCOP Domain Sequences for d8cgta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8cgta2 b.3.1.1 (A:580-684) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
ltgdqvtvrfvvnnasttlgqnlyltgnvaelgnwstgstaigpafnqvihqyptwyydv
svpagkqlefkffkkngstitwesgsnhtfttpasgtatvtvnwq

SCOP Domain Coordinates for d8cgta2:

Click to download the PDB-style file with coordinates for d8cgta2.
(The format of our PDB-style files is described here.)

Timeline for d8cgta2: