Class b: All beta proteins [48724] (119 folds) |
Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies) consists of eight 4-stranded beta-sheet motifs; meander also found in some members of the WD40-repeat superfamily |
Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) |
Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein) |
Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species) the N-terminal domain is cytochrome c-like |
Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries) |
Domain d1n90b2: 1n90 B:118-543 [27705] Other proteins in same PDB: d1n90a1, d1n90b1 complexed with dhe, hec |
PDB Entry: 1n90 (more details), 2.9 Å
SCOP Domain Sequences for d1n90b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n90b2 b.70.2.1 (B:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa} ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn tqhdvy
Timeline for d1n90b2: