Lineage for d1n90b2 (1n90 B:118-543)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 302133Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 302158Superfamily b.70.2: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51004] (1 family) (S)
  5. 302159Family b.70.2.1: C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51005] (1 protein)
  6. 302160Protein C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase [51006] (3 species)
    the N-terminal domain is cytochrome c-like
  7. 302189Species Pseudomonas aeruginosa [TaxId:287] [51008] (9 PDB entries)
  8. 302204Domain d1n90b2: 1n90 B:118-543 [27705]
    Other proteins in same PDB: d1n90a1, d1n90b1
    complexed with dhe, hec

Details for d1n90b2

PDB Entry: 1n90 (more details), 2.9 Å

PDB Description: following the c heme reduction in nitrite reductase from pseudomonas aeruginosa

SCOP Domain Sequences for d1n90b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n90b2 b.70.2.1 (B:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
ewgmpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidt
gyavhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyed
rytiagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivn
vketgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrr
lsalvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelq
gqgggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgeg
akrvvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyn
tqhdvy

SCOP Domain Coordinates for d1n90b2:

Click to download the PDB-style file with coordinates for d1n90b2.
(The format of our PDB-style files is described here.)

Timeline for d1n90b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n90b1