![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d4wv1d2: 4wv1 D:107-214 [277021] Other proteins in same PDB: d4wv1a1, d4wv1b_, d4wv1c_, d4wv1d1, d4wv1e_, d4wv1f_ automated match to d1dn0a2 |
PDB Entry: 4wv1 (more details), 2.36 Å
SCOPe Domain Sequences for d4wv1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wv1d2 b.1.1.2 (D:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d4wv1d2: