SCOPe 2.08: Domain d4wv1a2: 4wv1 A:107-214

Lineage for d4wv1a2 (4wv1 A:107-214)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d4wv1a2: 4wv1 A:107-214 [277023]
Other proteins in same PDB: d4wv1a1, d4wv1b_, d4wv1c_, d4wv1d1, d4wv1e_, d4wv1f_
automated match to d1dn0a2

Details for d4wv1a2

PDB Entry: 4wv1 (more details), 2.36 Å

PDB Description: crystal structure of the fgfr2 d2 domain in complex with fab 2b.1.3

PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d4wv1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wv1a2 b.1.1.2 (A:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d4wv1a2:

Click to download the PDB-style file with coordinates for d4wv1a2.
(The format of our PDB-style files is described here.)

Timeline for d4wv1a2: