![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein Fibroblast growth factor receptor, FGFR [49179] (4 species) |
![]() | Species Human (Homo sapiens), FGFR2a [TaxId:9606] [49181] (11 PDB entries) |
![]() | Domain d4wv1f_: 4wv1 F: [277004] Other proteins in same PDB: d4wv1a1, d4wv1a2, d4wv1b_, d4wv1d1, d4wv1d2, d4wv1e_ automated match to d1wvza_ |
PDB Entry: 4wv1 (more details), 2.36 Å
SCOPe Domain Sequences for d4wv1f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wv1f_ b.1.1.4 (F:) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} pywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykvrnqh wslimesvvpsdkgnytcvveneygsinhtyhldvver
Timeline for d4wv1f_: