Lineage for d4wv1e_ (4wv1 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743108Domain d4wv1e_: 4wv1 E: [409629]
    Other proteins in same PDB: d4wv1a1, d4wv1a2, d4wv1c_, d4wv1d1, d4wv1d2, d4wv1f_
    automated match to d6shgh_

Details for d4wv1e_

PDB Entry: 4wv1 (more details), 2.36 Å

PDB Description: crystal structure of the fgfr2 d2 domain in complex with fab 2b.1.3
PDB Compounds: (E:) Fab heavy chain

SCOPe Domain Sequences for d4wv1e_:

Sequence, based on SEQRES records: (download)

>d4wv1e_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftftstgiswvrqapgkglewvgrthlgdgstny
adsvkgrftisadtskntaylqmnslraedtavyycartygiydlyvdyteyvmdywgqg
tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d4wv1e_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslrlscaasgftftstgiswvrqapgkglewvgrthlgdgstny
adsvkgrftisadtskntaylqmnslraedtavyycartygiydlyvdyteyvmdywgqg
tlvtvssastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d4wv1e_:

Click to download the PDB-style file with coordinates for d4wv1e_.
(The format of our PDB-style files is described here.)

Timeline for d4wv1e_:

  • d4wv1e_ is new in SCOPe 2.08-stable