Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) |
Family c.1.24.0: automated matches [191640] (1 protein) not a true family |
Protein automated matches [191177] (4 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [276963] (1 PDB entry) |
Domain d5dlcd_: 5dlc D: [276966] automated match to d3gk0a_ complexed with po4 |
PDB Entry: 5dlc (more details), 2.65 Å
SCOPe Domain Sequences for d5dlcd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dlcd_ c.1.24.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} trillgvnidhvatlrqargtrypdpvkaaldaeeagadgitvhlredrrhiqerdvrvl kevlqtrmnfemgvteemlafaeeirpahsclvperreeltteggldvagqeqrirdavr rlaavgsevslfidpdprqieasarvgapaielhtgryadaedpeeqarelqrvregval grslglivnaghglhyhnvepvaaidginelnighaivahalfvgfrqavaemkalmlaa at
Timeline for d5dlcd_: