Lineage for d5dlcd_ (5dlc D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2449141Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) (S)
  5. 2449192Family c.1.24.0: automated matches [191640] (1 protein)
    not a true family
  6. 2449193Protein automated matches [191177] (4 species)
    not a true protein
  7. 2449206Species Pseudomonas aeruginosa [TaxId:287] [276963] (1 PDB entry)
  8. 2449210Domain d5dlcd_: 5dlc D: [276966]
    automated match to d3gk0a_
    complexed with po4

Details for d5dlcd_

PDB Entry: 5dlc (more details), 2.65 Å

PDB Description: x-ray crystal structure of a pyridoxine 5-prime-phosphate synthase from pseudomonas aeruginosa
PDB Compounds: (D:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d5dlcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dlcd_ c.1.24.0 (D:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
trillgvnidhvatlrqargtrypdpvkaaldaeeagadgitvhlredrrhiqerdvrvl
kevlqtrmnfemgvteemlafaeeirpahsclvperreeltteggldvagqeqrirdavr
rlaavgsevslfidpdprqieasarvgapaielhtgryadaedpeeqarelqrvregval
grslglivnaghglhyhnvepvaaidginelnighaivahalfvgfrqavaemkalmlaa
at

SCOPe Domain Coordinates for d5dlcd_:

Click to download the PDB-style file with coordinates for d5dlcd_.
(The format of our PDB-style files is described here.)

Timeline for d5dlcd_: