| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
| Protein Benzoylformate decarboxylase [52482] (1 species) |
| Species Pseudomonas putida [TaxId:303] [52483] (43 PDB entries) Uniprot P20906 |
| Domain d5deib2: 5dei B:183-342 [276924] Other proteins in same PDB: d5deia1, d5deia3, d5deib1, d5deib3, d5deic1, d5deic3, d5deid1, d5deid3 automated match to d1q6za1 complexed with bct, ca, mg, tdp |
PDB Entry: 5dei (more details), 1.3 Å
SCOPe Domain Sequences for d5deib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5deib2 c.31.1.3 (B:183-342) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d5deib2: