SCOPe 2.06: Domain d4r8wa_: 4r8w A:

Lineage for d4r8wa_ (4r8w A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (34 species)
   not a true protein

7. Species Influenza a virus (a/anhui/1-balf_rg45/2013(h7n9)) [TaxId:1481988] [276340] (1 PDB entry)

8. Domain d4r8wa_: 4r8w A: [276341]
   Other proteins in same PDB: d4r8wb_, d4r8wl_
   automated match to d4n62a_
   complexed with nag

Details for d4r8wa_

PDB Entry: 4r8w, 2.79 Å

PDB Description: crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4r8wa_:

Sequence; same for both SEQRES and ATOM records:

>d4r8wa_ b.19.1.0 (A:) automated matches {Influenza a virus (a/anhui/1-balf_rg45/2013(h7n9)) [TaxId: 1481988]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

Timeline for d4r8wa_:

• d4r8wa_ first appeared in SCOPe 2.05
  
• d4r8wa_ appears in SCOPe 2.07
  
• d4r8wa_ appears in the current release, SCOPe 2.08