PDB entry 4r8w

View 4r8w on RCSB PDB site
Description: Crystal structure of H7 hemagglutinin from A/Anhui/1/2013 in complex with a neutralizing antibody CT149
Class: immune system
Keywords: Influenza A Virus, Hemagglutinin, neutralizing antibody, IMMUNE SYSTEM
Deposited on 2014-09-03, released 2015-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-26, with a file datestamp of 2015-08-21.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Anhui/1-BALF_RG45/2013(H7N9)) [TaxId:1481988]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r8wa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Anhui/1-BALF_RG45/2013(H7N9)) [TaxId:1481988]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4r8wb_
  • Chain 'H':
    Compound: Heavy chain of neutralizing antibody CT149
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R8W (0-End)
  • Chain 'L':
    Compound: Light chain of neutralizing antibody CT149
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4R8W (0-End)
    Domains in SCOPe 2.06: d4r8wl_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4r8wA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpeipkgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r8wA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
    eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4r8wB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnriqidpvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r8wB (B:)
    lfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektnq
    qfelidnefnevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklyer
    vkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4r8wL (L:)
    evvltqspgtlalppgeratlscrashrvgstyiawyqqksgqaprrliygasnratdip
    drfsgsgsgtdftltirrlepedsavyycqqfsvspwtfgqgtrveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4r8wL (L:)
    evvltqspgtlalppgeratlscrashrvgstyiawyqqksgqaprrliygasnratdip
    drfsgsgsgtdftltirrlepedsavyycqqfsvspwtfgqgtrveikrt