Lineage for d4r8wa_ (4r8w A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776222Species Influenza A virus (a/anhui/1-balf_rg45/2013(h7n9)) [TaxId:1481988] [276340] (1 PDB entry)
  8. 2776223Domain d4r8wa_: 4r8w A: [276341]
    Other proteins in same PDB: d4r8wb_, d4r8wh_, d4r8wl_
    automated match to d4n62a_
    complexed with nag

Details for d4r8wa_

PDB Entry: 4r8w (more details), 2.8 Å

PDB Description: crystal structure of h7 hemagglutinin from a/anhui/1/2013 in complex with a neutralizing antibody ct149
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4r8wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r8wa_ b.19.1.0 (A:) automated matches {Influenza A virus (a/anhui/1-balf_rg45/2013(h7n9)) [TaxId: 1481988]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

SCOPe Domain Coordinates for d4r8wa_:

Click to download the PDB-style file with coordinates for d4r8wa_.
(The format of our PDB-style files is described here.)

Timeline for d4r8wa_: