Lineage for d5ct2b2 (5ct2 B:126-209)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638015Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2638032Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 2638033Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries)
  8. 2638057Domain d5ct2b2: 5ct2 B:126-209 [275896]
    Other proteins in same PDB: d5ct2a1, d5ct2b1
    automated match to d1nk1a2
    complexed with cxs

Details for d5ct2b2

PDB Entry: 5ct2 (more details), 2 Å

PDB Description: the structure of the nk1 fragment of hgf/sf complexed with caps
PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d5ct2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ct2b2 g.14.1.1 (B:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcsev

SCOPe Domain Coordinates for d5ct2b2:

Click to download the PDB-style file with coordinates for d5ct2b2.
(The format of our PDB-style files is described here.)

Timeline for d5ct2b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ct2b1