Class g: Small proteins [56992] (98 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein NK1 fragment of hepatocyte growth factor [57457] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57458] (18 PDB entries) |
Domain d5ct2a2: 5ct2 A:126-210 [275894] Other proteins in same PDB: d5ct2a1, d5ct2b1 automated match to d1nk1a2 complexed with cxs |
PDB Entry: 5ct2 (more details), 2 Å
SCOPe Domain Sequences for d5ct2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ct2a2 g.14.1.1 (A:126-210) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]} rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg gpwcftsnpevryevcdipqcseve
Timeline for d5ct2a2: