SCOPe 2.05: Domain d5ccjb_: 5ccj B:

Lineage for d5ccjb_ (5ccj B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein automated matches [190234] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries)

8. Domain d5ccjb_: 5ccj B: [275847]
   automated match to d2lhaa_
   complexed with gol, so4; mutant

Details for d5ccjb_

PDB Entry: 5ccj, 1.65 Å

PDB Description: crystal structure of the quintuple mutant of the synaptotagmin-1 c2b domain

PDB Compounds: (B:) Synaptotagmin-1

SCOPe Domain Sequences for d5ccjb_:

Sequence; same for both SEQRES and ATOM records:

>d5ccjb_ b.7.1.2 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgdicfslayvptagkltvvilaaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpwynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanpaapiaqwhtlqveeevdamlavkk

Timeline for d5ccjb_:

• d5ccjb_ is new in SCOPe 2.05-stable
  
• d5ccjb_ appears in SCOPe 2.06
  
• d5ccjb_ appears in the current release, SCOPe 2.08