Lineage for d5ccjb_ (5ccj B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1775884Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1776026Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 1776088Protein automated matches [190234] (2 species)
    not a true protein
  7. 1776095Species Norway rat (Rattus norvegicus) [TaxId:10116] [186999] (6 PDB entries)
  8. 1776104Domain d5ccjb_: 5ccj B: [275847]
    automated match to d2lhaa_
    complexed with gol, so4; mutant

Details for d5ccjb_

PDB Entry: 5ccj (more details), 1.65 Å

PDB Description: crystal structure of the quintuple mutant of the synaptotagmin-1 c2b domain
PDB Compounds: (B:) Synaptotagmin-1

SCOPe Domain Sequences for d5ccjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ccjb_ b.7.1.2 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgdicfslayvptagkltvvilaaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpwynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanpaapiaqwhtlqveeevdamlavkk

SCOPe Domain Coordinates for d5ccjb_:

Click to download the PDB-style file with coordinates for d5ccjb_.
(The format of our PDB-style files is described here.)

Timeline for d5ccjb_: