SCOPe 2.06: Domain d5bnyb_: 5bny B:

Lineage for d5bnyb_ (5bny B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (23 species)
   not a true protein

7. Species Influenza a virus [TaxId:1454272] [275804] (3 PDB entries)

8. Domain d5bnyb_: 5bny B: [275809]
   Other proteins in same PDB: d5bnya_, d5bnyc_, d5bnye_
   automated match to d4d00d_
   complexed with nag

Details for d5bnyb_

PDB Entry: 5bny, 2.66 Å

PDB Description: crystal structure of hemagglutinin of a/chicken/guangdong/s1311/2010 (h6n6)

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d5bnyb_:

Sequence; same for both SEQRES and ATOM records:

>d5bnyb_ h.3.1.0 (B:) automated matches {Influenza a virus [TaxId: 1454272]}
glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrq

Timeline for d5bnyb_:

• d5bnyb_ first appeared in SCOPe 2.05
  
• d5bnyb_ appears in SCOPe 2.07
  
• d5bnyb_ appears in the current release, SCOPe 2.08