PDB entry 5bny

View 5bny on RCSB PDB site
Description: Crystal structure of hemagglutinin of A/Chicken/Guangdong/S1311/2010 (H6N6)
Class: viral protein
Keywords: influenza, heamgglutinin, VIRAL PROTEIN
Deposited on 2015-05-26, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Guangdong/S1311/2010(H6N6)) [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bnya_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bnyb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Guangdong/S1311/2010(H6N6)) [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bnyc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bnyd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/chicken/Guangdong/S1311/2010(H6N6)) [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bnye_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:1454272]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5bnyf_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bnyA (A:)
    dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
    ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
    twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
    hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
    nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
    igecpkyvkskslrlatglrnvpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bnyB (B:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesvklen
    fdvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bnyB (B:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bnyC (C:)
    dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
    ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
    twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
    hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
    nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
    igecpkyvkskslrlatglrnvpq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bnyD (D:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesvklen
    fdvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bnyD (D:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqki
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5bnyE (E:)
    dkicigyhannsttkvdtileknvtvthsvellenqkeerfckisnkapldlrdctlegw
    ilgnprcgilladqswsyiverpnarngicypgtlneaeelkaligsgerverfemfpks
    twtgvntesgvssacplgngpsfyrnllwiiklksseypvirgtfnntgdksilyfwgvh
    hppvtteqnalygsgdryvrmgtesmnfarspeiaarpavngqrgridyfwsilkpgetl
    nvesngnliapwyayrfvnkdskgaifrsnlpiencdatcqttegvirtnktfqnvsplw
    igecpkyvkskslrlatglrnvpq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5bnyF (F:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesvklen
    fdvyqgalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bnyF (F:)
    glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
    tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
    kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesv