| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
| Protein automated matches [254645] (23 species) not a true protein |
| Species Influenza a virus [TaxId:1454272] [275804] (3 PDB entries) |
| Domain d5bnyf_: 5bny F: [275813] Other proteins in same PDB: d5bnya_, d5bnyc_, d5bnye_ automated match to d4d00d_ complexed with nag |
PDB Entry: 5bny (more details), 2.66 Å
SCOPe Domain Sequences for d5bnyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bnyf_ h.3.1.0 (F:) automated matches {Influenza a virus [TaxId: 1454272]}
glfgaiagfieggwtgmidgwygyhhensqgsgyaadkestqkaidgitnkvnsiidkmn
tqfeavghefsnlerridnlnkrmedgfldvwtynaellvllenertldlhdanvknlhe
kvrsqlrdnandlgngcfefwhkcnnecmesvkngtydypkyqkesrlnrqkiesv
Timeline for d5bnyf_: