Lineage for d4u61g_ (4u61 G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2823225Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2823226Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2823296Protein automated matches [191200] (13 species)
    not a true protein
  7. 2823611Species Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909] [275642] (6 PDB entries)
  8. 2823633Domain d4u61g_: 4u61 G: [275672]
    automated match to d4mbzj_
    complexed with gol, sia

Details for d4u61g_

PDB Entry: 4u61 (more details), 1.65 Å

PDB Description: trichodysplasia spinulosa-associated polyomavirus (tspyv) vp1 in complex with 6'-sialyllactose
PDB Compounds: (G:) Structural protein VP1

SCOPe Domain Sequences for d4u61g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u61g_ b.121.6.1 (G:) automated matches {Trichodysplasia spinulosa-associated polyomavirus [TaxId: 862909]}
evlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptyst
arinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnf
hmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvec
wcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdiv
gflvgkdgdmqyrglpryfnillrkrtvrn

SCOPe Domain Coordinates for d4u61g_:

Click to download the PDB-style file with coordinates for d4u61g_.
(The format of our PDB-style files is described here.)

Timeline for d4u61g_: