Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Streptomyces lavendulae [TaxId:1914] [275483] (2 PDB entries) |
Domain d3x43g_: 3x43 G: [275490] automated match to d4ofxa_ complexed with plp |
PDB Entry: 3x43 (more details), 2.25 Å
SCOPe Domain Sequences for d3x43g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3x43g_ c.79.1.0 (G:) automated matches {Streptomyces lavendulae [TaxId: 1914]} plfnsildtigrtpivrlqrmapehtsvyvkvesfnpggsvkdrlalsvvldaeakgllk pgdtivectsgnvgialamvaaargyrfvavmgdtysverrklirayggklvlfpghlgs kggnliadelaekygwfrarqfdnpanpsyhrettaseiladfagkrldhfvtgfgttgt ltgvgqmlrvarpevrvvalepsnaamlargewsphqiqglapnfvpgvldrsviddlvt mdevtardtsrrlaaeegifagisagatvatalsiaehapegtvllamlpdtgerylstf lfdgvdegsddawlasl
Timeline for d3x43g_: