Lineage for d3x43g_ (3x43 G:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2157251Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2157252Protein automated matches [190215] (33 species)
    not a true protein
  7. 2157452Species Streptomyces lavendulae [TaxId:1914] [275483] (2 PDB entries)
  8. 2157461Domain d3x43g_: 3x43 G: [275490]
    automated match to d4ofxa_
    complexed with plp

Details for d3x43g_

PDB Entry: 3x43 (more details), 2.25 Å

PDB Description: crystal structure of o-ureido-l-serine synthase
PDB Compounds: (G:) O-ureido-L-serine synthase

SCOPe Domain Sequences for d3x43g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x43g_ c.79.1.0 (G:) automated matches {Streptomyces lavendulae [TaxId: 1914]}
plfnsildtigrtpivrlqrmapehtsvyvkvesfnpggsvkdrlalsvvldaeakgllk
pgdtivectsgnvgialamvaaargyrfvavmgdtysverrklirayggklvlfpghlgs
kggnliadelaekygwfrarqfdnpanpsyhrettaseiladfagkrldhfvtgfgttgt
ltgvgqmlrvarpevrvvalepsnaamlargewsphqiqglapnfvpgvldrsviddlvt
mdevtardtsrrlaaeegifagisagatvatalsiaehapegtvllamlpdtgerylstf
lfdgvdegsddawlasl

SCOPe Domain Coordinates for d3x43g_:

Click to download the PDB-style file with coordinates for d3x43g_.
(The format of our PDB-style files is described here.)

Timeline for d3x43g_: