Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (38 species) not a true protein |
Species Coxiella burnetii [TaxId:227377] [236642] (1 PDB entry) |
Domain d4ofxa_: 4ofx A: [236643] automated match to d1z7wa1 complexed with na |
PDB Entry: 4ofx (more details), 1.74 Å
SCOPe Domain Sequences for d4ofxa_:
Sequence, based on SEQRES records: (download)
>d4ofxa_ c.79.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 227377]} mvldnilqvigktpvvrlhrigqslpcelygkceflnpggsvkdrigaamiesaekqgki kpgdtlieptsgntgigialagavkgyrviitmpekmshekqvvlealgatiyrtpteaa yddpeshislakrlnqeipnsyildqysnaenpdihyqttgqeilddmgenlsmvvmgvg tggtiigvakklkevnpsiqiigvdpigsilgggdeikpylvegigydfipevldnnlid eyikindkdsflmarrlireegllvggssgsavwaacqaaqrlkegerclvilpdairny ltkfvddawmkaqgfl
>d4ofxa_ c.79.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 227377]} mvldnilqvigktpvvrlhrigqslpcelygkceflnpggsvkdrigaamiesaekqgki kpgdtlieptsgntgigialagavkgyrviitmpekmshekqvvlealgatiyrtpeshi slakrlnqeipnsyildqysnaenpdihyqttgqeilddmgenlsmvvmgvgtggtiigv akklkevnpsiqiigvdpigsilgggdnnlideyikindkdsflmarrlireegllvggs sgsavwaacqaaqrlkegerclvilpdairnyltkfvddawmkaqgfl
Timeline for d4ofxa_: