Lineage for d4ofxa_ (4ofx A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140095Species Coxiella burnetii [TaxId:227377] [236642] (1 PDB entry)
  8. 2140096Domain d4ofxa_: 4ofx A: [236643]
    automated match to d1z7wa1
    complexed with na

Details for d4ofxa_

PDB Entry: 4ofx (more details), 1.74 Å

PDB Description: Crystal Structure of a Putative Cystathionine beta-Synthase from Coxiella burnetii
PDB Compounds: (A:) cystathionine beta-synthase

SCOPe Domain Sequences for d4ofxa_:

Sequence, based on SEQRES records: (download)

>d4ofxa_ c.79.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 227377]}
mvldnilqvigktpvvrlhrigqslpcelygkceflnpggsvkdrigaamiesaekqgki
kpgdtlieptsgntgigialagavkgyrviitmpekmshekqvvlealgatiyrtpteaa
yddpeshislakrlnqeipnsyildqysnaenpdihyqttgqeilddmgenlsmvvmgvg
tggtiigvakklkevnpsiqiigvdpigsilgggdeikpylvegigydfipevldnnlid
eyikindkdsflmarrlireegllvggssgsavwaacqaaqrlkegerclvilpdairny
ltkfvddawmkaqgfl

Sequence, based on observed residues (ATOM records): (download)

>d4ofxa_ c.79.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 227377]}
mvldnilqvigktpvvrlhrigqslpcelygkceflnpggsvkdrigaamiesaekqgki
kpgdtlieptsgntgigialagavkgyrviitmpekmshekqvvlealgatiyrtpeshi
slakrlnqeipnsyildqysnaenpdihyqttgqeilddmgenlsmvvmgvgtggtiigv
akklkevnpsiqiigvdpigsilgggdnnlideyikindkdsflmarrlireegllvggs
sgsavwaacqaaqrlkegerclvilpdairnyltkfvddawmkaqgfl

SCOPe Domain Coordinates for d4ofxa_:

Click to download the PDB-style file with coordinates for d4ofxa_.
(The format of our PDB-style files is described here.)

Timeline for d4ofxa_: