SCOPe 2.08: Domain d5cnpd1: 5cnp D:1-173

Lineage for d5cnpd1 (5cnp D:1-173)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (49 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)

8. Domain d5cnpd1: 5cnp D:1-173 [275374]
   Other proteins in same PDB: d5cnpa2, d5cnpd2
   automated match to d3eg7b_
   complexed with ipa, mg

Details for d5cnpd1

PDB Entry: 5cnp, 2.38 Å

PDB Description: x-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae.

PDB Compounds: (D:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d5cnpd1:

Sequence; same for both SEQRES and ATOM records:

>d5cnpd1 d.108.1.0 (D:1-173) automated matches {Vibrio cholerae [TaxId: 666]}
mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvv
edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy
lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse

Timeline for d5cnpd1:

• d5cnpd1 first appeared in SCOPe 2.05, called d5cnpd_
  
• d5cnpd1 appears in SCOPe 2.07