Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (49 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries) |
Domain d5cnpd1: 5cnp D:1-173 [275374] Other proteins in same PDB: d5cnpa2, d5cnpd2 automated match to d3eg7b_ complexed with ipa, mg |
PDB Entry: 5cnp (more details), 2.38 Å
SCOPe Domain Sequences for d5cnpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cnpd1 d.108.1.0 (D:1-173) automated matches {Vibrio cholerae [TaxId: 666]} mnsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvv edaqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiy lhvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnrse
Timeline for d5cnpd1: