Lineage for d5cnpf_ (5cnp F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969531Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)
  8. 2969615Domain d5cnpf_: 5cnp F: [275372]
    Other proteins in same PDB: d5cnpa2, d5cnpd2
    automated match to d3eg7b_
    complexed with ipa, mg

Details for d5cnpf_

PDB Entry: 5cnp (more details), 2.38 Å

PDB Description: x-ray crystal structure of spermidine n1-acetyltransferase from vibrio cholerae.
PDB Compounds: (F:) Spermidine N(1)-acetyltransferase

SCOPe Domain Sequences for d5cnpf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cnpf_ d.108.1.0 (F:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfeepyesfdeleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskyln

SCOPe Domain Coordinates for d5cnpf_:

Click to download the PDB-style file with coordinates for d5cnpf_.
(The format of our PDB-style files is described here.)

Timeline for d5cnpf_: