Lineage for d1c39a_ (1c39 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.64: Extracytoplasmic domain of cation-dependent mannose 6-phosphate receptor [50910] (1 superfamily) Superfamily b.64.1: Extracytoplasmic domain of cation-dependent mannose 6-phosphate receptor [50911] (1 family) 
Family b.64.1.1: Extracytoplasmic domain of cation-dependent mannose 6-phosphate receptor [50912] (1 protein) Protein Extracytoplasmic domain of cation-dependent mannose 6-phosphate receptor [50913] (1 species) Species Cow (Bos taurus) [TaxId:9913] [50914] (2 PDB entries) 
Domain d1c39a_: 1c39 A: [27517]
Details for d1c39a_
PDB Entry: 1c39 (more details), 1.85 Å
PDB Description: structure of cation-dependent mannose 6-phosphate receptor bound to pentamannosyl phosphate
SCOP Domain Sequences for d1c39a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c39a_ b.64.1.1 (A:) Extracytoplasmic domain of cation-dependent mannose 6-phosphate receptor {Cow (Bos taurus)}
ektcdlvgekgkesekelallkrltplfqksfestvgqspdmysyvfrvcreagqhssga
glvqiqksngketvvgrfnetqifqgsnwimliykggdeydnhcgreqrravvmiscnrh
tladnfnpvseergkvqdcfylfemdsslacs
SCOP Domain Coordinates for d1c39a_:
Click to download the PDB-style file with coordinates for d1c39a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c39a_:
- d1c39a_ appears in SCOP 1.57
- d1c39a_ appears in the current release, SCOPe 2.08
View in 3D
