Lineage for d4xb5a1 (4xb5 A:2-173)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348932Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2348933Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2348934Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins)
  6. 2348939Protein automated matches [227037] (2 species)
    not a true protein
  7. 2348940Species Synechocystis sp. [TaxId:1111708] [275030] (5 PDB entries)
  8. 2348944Domain d4xb5a1: 4xb5 A:2-173 [275031]
    Other proteins in same PDB: d4xb5a2
    automated match to d1m98a1
    complexed with 45d, gol

Details for d4xb5a1

PDB Entry: 4xb5 (more details), 1.9 Å

PDB Description: structure of orange carotenoid protein binding canthaxanthin
PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d4xb5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xb5a1 a.175.1.1 (A:2-173) automated matches {Synechocystis sp. [TaxId: 1111708]}
pftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasm
qlaenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgf
vapipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria

SCOPe Domain Coordinates for d4xb5a1:

Click to download the PDB-style file with coordinates for d4xb5a1.
(The format of our PDB-style files is described here.)

Timeline for d4xb5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xb5a2