![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily) multihelical; array |
![]() | Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) ![]() duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains automatically mapped to Pfam PF09150 |
![]() | Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins) |
![]() | Protein automated matches [227037] (2 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1111708] [275030] (5 PDB entries) |
![]() | Domain d4xb5a1: 4xb5 A:2-173 [275031] Other proteins in same PDB: d4xb5a2 automated match to d1m98a1 complexed with 45d, gol |
PDB Entry: 4xb5 (more details), 1.9 Å
SCOPe Domain Sequences for d4xb5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xb5a1 a.175.1.1 (A:2-173) automated matches {Synechocystis sp. [TaxId: 1111708]} pftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasm qlaenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgf vapipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria
Timeline for d4xb5a1: