Lineage for d4xb5a2 (4xb5 A:174-314)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542783Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2543372Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2544255Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2544256Protein automated matches [190205] (33 species)
    not a true protein
  7. 2544427Species Synechocystis sp. [TaxId:1111708] [275032] (5 PDB entries)
  8. 2544431Domain d4xb5a2: 4xb5 A:174-314 [275033]
    Other proteins in same PDB: d4xb5a1
    automated match to d1m98a2
    complexed with 45d, gol

Details for d4xb5a2

PDB Entry: 4xb5 (more details), 1.9 Å

PDB Description: structure of orange carotenoid protein binding canthaxanthin
PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d4xb5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xb5a2 d.17.4.0 (A:174-314) automated matches {Synechocystis sp. [TaxId: 1111708]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspkelln

SCOPe Domain Coordinates for d4xb5a2:

Click to download the PDB-style file with coordinates for d4xb5a2.
(The format of our PDB-style files is described here.)

Timeline for d4xb5a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xb5a1