SCOP 1.59: Domain d1a58__: 1a58 -

Lineage for d1a58__ (1a58 -)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)

4. Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)

6. Protein Cyclophilin (eukaryotic) [50893] (7 species)

7. Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)

8. Domain d1a58__: 1a58 - [27495]

Details for d1a58__

PDB Entry: 1a58, 1.95 Å

PDB Description: cyclophilin from brugia malayi

SCOP Domain Sequences for d1a58__:

Sequence; same for both SEQRES and ATOM records:

>d1a58__ b.62.1.1 (-) Cyclophilin (eukaryotic) {Nematode (Brugia malayi)}
mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

Timeline for d1a58__:

• d1a58__ first appeared (with stable ids) in SCOP 1.55
  
• d1a58__ appears in SCOP 1.57
  
• d1a58__ appears in SCOP 1.61
  
• d1a58__ appears in the current release, SCOPe 2.08, called d1a58a_