Lineage for d1a58__ (1a58 -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily) Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) 
Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins) Protein Cyclophilin (eukaryotic) [50893] (7 species) 
Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries) 
Domain d1a58__: 1a58 - [27495]
Details for d1a58__
PDB Entry: 1a58 (more details), 1.95 Å
PDB Description: cyclophilin from brugia malayi
SCOP Domain Sequences for d1a58__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a58__ b.62.1.1 (-) Cyclophilin (eukaryotic) {Nematode (Brugia malayi)}
mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv
SCOP Domain Coordinates for d1a58__:
Click to download the PDB-style file with coordinates for d1a58__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a58__:
- d1a58__ first appeared (with stable ids) in SCOP 1.55
- d1a58__ appears in SCOP 1.59
- d1a58__ appears in the current release, SCOPe 2.08, called d1a58a_
View in 3D