Lineage for d1a58__ (1a58 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16874Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
  4. 16875Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 16876Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (2 proteins)
  6. 16882Protein Cyclophilin (eukaryotic) [50893] (7 species)
  7. 16965Species Nematode (Brugia malayi) [TaxId:6279] [50898] (3 PDB entries)
  8. 16967Domain d1a58__: 1a58 - [27495]

Details for d1a58__

PDB Entry: 1a58 (more details), 1.95 Å

PDB Description: cyclophilin from brugia malayi

SCOP Domain Sequences for d1a58__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a58__ b.62.1.1 (-) Cyclophilin (eukaryotic) {Nematode (Brugia malayi)}
mskkdrrrvfldvtidgnlagrivmelyndiaprtcnnflmlctgmagtgkisgkplhyk
gstfhrviknfmiqggdftkgdgtggesiyggmfddeefvmkhdepfvvsmankgpntng
sqffitttpaphlnnihvvfgkvvsgqevvtkieylktnsknrpladvvilncgelv

SCOP Domain Coordinates for d1a58__:

Click to download the PDB-style file with coordinates for d1a58__.
(The format of our PDB-style files is described here.)

Timeline for d1a58__: