SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1awtd_ (1awt D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064271Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2064272Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2064273Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 protein domains)
    automatically mapped to Pfam PF00160
  6. 2064274Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2064289Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (97 PDB entries)
    Uniprot P05092
  8. 2064403Domain d1awtd_: 1awt D: [27484]

Details for d1awtd_

PDB Entry: 1awt (more details), 2.55 Å

PDB Description: secypa complexed with hagpia
PDB Compounds: (D:) cyclophilin a

SCOPe Domain Sequences for d1awtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1awtd_ b.62.1.1 (D:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d1awtd_:

Click to download the PDB-style file with coordinates for d1awtd_.
(The format of our PDB-style files is described here.)

Timeline for d1awtd_: