SCOPe 2.08: Domain d1awtc_: 1awt C:

Lineage for d1awtc_ (1awt C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein Cyclophilin (eukaryotic) [50893] (13 species)

7. Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (136 PDB entries)
   Uniprot P05092

8. Domain d1awtc_: 1awt C: [27483]

Details for d1awtc_

PDB Entry: 1awt, 2.55 Å

PDB Description: secypa complexed with hagpia

PDB Compounds: (C:) cyclophilin a

SCOPe Domain Sequences for d1awtc_:

Sequence; same for both SEQRES and ATOM records:

>d1awtc_ b.62.1.1 (C:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

Timeline for d1awtc_:

• d1awtc_ first appeared (with stable ids) in SCOP 1.55
  
• d1awtc_ appears in SCOPe 2.07